Protein Info for SM_b20692 in Sinorhizobium meliloti 1021

Annotation: 5-keto-D-gluconate 5-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 239 to 258 (20 residues), see Phobius details PF00106: adh_short" amino acids 24 to 217 (194 residues), 200.3 bits, see alignment E=3.4e-63 PF08659: KR" amino acids 26 to 175 (150 residues), 53.8 bits, see alignment E=3.7e-18 PF13561: adh_short_C2" amino acids 33 to 265 (233 residues), 207.7 bits, see alignment E=3e-65

Best Hits

Swiss-Prot: 56% identical to GNO_GLUOX: Gluconate 5-dehydrogenase (gno) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 100% identity to sme:SM_b20692)

MetaCyc: 56% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"5-keto-D-gluconate 5-reductase (EC 1.1.1.69)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.69)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.69

Use Curated BLAST to search for 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TU6 at UniProt or InterPro

Protein Sequence (268 amino acids)

>SM_b20692 5-keto-D-gluconate 5-reductase (Sinorhizobium meliloti 1021)
MMDGASNAAPRIRGLPALFDLSGRVALITGSSGGLGLTMAHALCEAGASVILNGRDEARL
AGARAELEEHGFTVGTSAFDVTKSAEIGRAVADILAERGRIDILVNNAGIQHRTPLHEFP
EDAFRRVIETNLTSAFLVGQAVVQGMIERREGTIINICSVQSELARPSIAPYAASKGGLK
MLTKGMALDWGRYGIRVNGLAPGYFKTELNSALVSDEKFSTWLEQRTPLGRWGDTGELAA
AAVFLASAASSFVTGHILYVDGGITSCL