Protein Info for SM_b20687 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13174: TPR_6" amino acids 206 to 230 (25 residues), 12.5 bits, see alignment (E = 0.00011) PF13432: TPR_16" amino acids 207 to 268 (62 residues), 23.4 bits, see alignment E=3.9e-08 amino acids 283 to 330 (48 residues), 21.4 bits, see alignment 1.6e-07 PF13431: TPR_17" amino acids 260 to 291 (32 residues), 24.9 bits, see alignment (E = 8.6e-09) PF07721: TPR_4" amino acids 273 to 296 (24 residues), 16.2 bits, see alignment (E = 7.4e-06) amino acids 310 to 328 (19 residues), 11.8 bits, see alignment (E = 0.00019) PF14559: TPR_19" amino acids 284 to 343 (60 residues), 34.2 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20687)

Predicted SEED Role

"probable O-linked GlcNAc transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TV1 at UniProt or InterPro

Protein Sequence (361 amino acids)

>SM_b20687 hypothetical protein (Sinorhizobium meliloti 1021)
MALAGRTFGIVGALAAFPRRLAAREVERQGGHLRRGVNRQTKFVVFGRGLLAKASEAEIE
ARFDSESGQRRRVLSENGFLRLLGLASAPETSALTRQSLVDQSGLSPRHLDLLSLFDAFE
HDGEPYSFRDLILARKYAGLMASGAGWGAIARSVHRSGNVASLTALSLHHEGKDTIYARR
AEGLSELDGQLLLDVGSPDEEALEDLFAQAEAAEEAGEYDQAAAFYQRYLAIDRTDEVAA
FNRANCLRAAGREAEAAHDYARAIKLDPCFVEAWFNLAGLMGERGRTDTARRHLRRAIEI
DGDYADAIFNLAKLEFDAGNLAEARRWWMRYLELDQHSEWARAAERGVQFVNLHLLSRTA
G