Protein Info for SM_b20684 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR03214: putative allantoin catabolism protein" amino acids 5 to 271 (267 residues), 397 bits, see alignment E=1.9e-123 PF05899: Cupin_3" amino acids 63 to 144 (82 residues), 34.9 bits, see alignment E=2.1e-12 PF07883: Cupin_2" amino acids 71 to 140 (70 residues), 43.6 bits, see alignment E=3.9e-15 amino acids 194 to 259 (66 residues), 34.5 bits, see alignment E=2.6e-12

Best Hits

KEGG orthology group: K14977, ureidoglycine aminohydrolase [EC: 3.5.3.-] (inferred from 100% identity to smk:Sinme_4344)

Predicted SEED Role

"Ureidoglycine aminohydrolase"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TV4 at UniProt or InterPro

Protein Sequence (278 amino acids)

>SM_b20684 hypothetical protein (Sinorhizobium meliloti 1021)
MQKNYYFPVGGHPPQTNLLSDRAIFTEAYAIIPKGVMRDIVTSYLPFWTNTRLWVLSRPL
SGFAETFSQYIMEVGPSGGSNRPETDPRAEAVLFVVDGEFHLTLGDETHLMQSGGYAFIP
PGTEWSLRNESGAPTRFHWIRKAYEKVDGVPLPEPIVTNERDIPPSPMPETDGRWATTRF
VDPSDMRHDMHVTIVTFEPGGVIPFMETHVMEHGLYVLEGKAVYRLNNDWVEVEAGDYMW
LRAFCPQACYAGGPGKFRYLLYKDVNRHMTLGNPGRLA