Protein Info for SM_b20674 in Sinorhizobium meliloti 1021

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF00356: LacI" amino acids 1 to 45 (45 residues), 50.9 bits, see alignment 2.2e-17 PF00532: Peripla_BP_1" amino acids 57 to 317 (261 residues), 120.4 bits, see alignment E=2.1e-38 PF13407: Peripla_BP_4" amino acids 59 to 306 (248 residues), 61.2 bits, see alignment E=2.4e-20 PF13377: Peripla_BP_3" amino acids 167 to 327 (161 residues), 133.9 bits, see alignment E=1.2e-42

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to sme:SM_b20674)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TW4 at UniProt or InterPro

Protein Sequence (339 amino acids)

>SM_b20674 LacI family transcriptional regulator (Sinorhizobium meliloti 1021)
MLDVAKAAHVSVATVSAVINGSAPVSPELRNRIEQAIGLIGYKRNAIARSLKLGTTRTVG
LMVADITNPFFTDVVAVIQDVLHRAGYAVMLCCNDEDVALQDEQIALLIDRSVDGLIIAP
AGDDETLKRMIASANLPTVLIDRLCDGIDTDAVVLDNRRAVQDATIYMLGLGHRRIGYIS
GSLDTSTGRERLAGYRAALEAAGLPCEEDLIRIGNFREKDAYTAALQLLTSPERPTAIFS
ANNLMVIGVMKAIRDIGLHCPDDVSVASFDDFPWADVFQPHLTTIAQPVQAIGEQAAQLV
LDRLSGASPEAPRRLVLQGRLVIRDSCRPVGSLAPRAIA