Protein Info for SM_b20667 in Sinorhizobium meliloti 1021

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00356: LacI" amino acids 12 to 57 (46 residues), 57.7 bits, see alignment 1.6e-19 PF13407: Peripla_BP_4" amino acids 71 to 261 (191 residues), 44.9 bits, see alignment E=2.2e-15 PF00532: Peripla_BP_1" amino acids 71 to 315 (245 residues), 63 bits, see alignment E=6.8e-21 PF13377: Peripla_BP_3" amino acids 178 to 315 (138 residues), 75.2 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 100% identity to sme:SM_b20667)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TX0 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SM_b20667 LacI family transcriptional regulator (Sinorhizobium meliloti 1021)
MTTDFKQQTTVTLAEVAEAAGVGESTVSRVLRNHGSFSGKARERVLDAVERLGYVPNRIA
GTLASAGSRLVAFVIPSLTNIVFPDVLRGAGAVLEENRYQAVFSVTDYEPEREEALVAAM
LAWRPTAVMLAGFEHTEGTLKMLRASGCRVVELLDIDGTAIDLAVGFSNREAGRASAEFL
LKRGYRRIGYVGHDLGRDTRAGKRFEGFREALNLAGVPLVDREIRAGASSVGSGRAGLEQ
LLRRAPGLDAVYFSNDDMALGGYFHCLARTIPVPTRLALFGHNGLDIGQATPQPLTTIRT
PRVATGKLAAELVINDHPSHVADLGFELIEGATA