Protein Info for SM_b20666 in Sinorhizobium meliloti 1021

Annotation: aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00596: Aldolase_II" amino acids 8 to 187 (180 residues), 160.6 bits, see alignment E=2.1e-51

Best Hits

Swiss-Prot: 53% identical to OTNC_CUPNH: 3-oxo-tetronate 4-phosphate decarboxylase (otnC) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4362)

MetaCyc: 47% identical to 3-dehydro-4-phosphotetronate decarboxylase (Haemophilus influenzae Rd KW20)
RXN-18589 [EC: 1.1.1.409, 4.1.1.104]; RXN-18588 [EC: 1.1.1.409, 4.1.1.104, 1.1.1.408]

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.408 or 1.1.1.409 or 4.1.1.104

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TX1 at UniProt or InterPro

Protein Sequence (225 amino acids)

>SM_b20666 aldolase (Sinorhizobium meliloti 1021)
MSETRLREEICRYGRSLFERGLTPGSSGNISMRLEDGGWLVTPTNASLGFLDPARISRLD
AGGRLVSGDKPTKEIPLHSALYETRGSARAIVHLHSTHAVALTMLPEIDARAALPPMTPY
YLMRAGETALVPYYRPGDPAVADAIRGLAGRYSSVLLSNHGPVVAGDSLEAAVFATEELE
ETAKLYLLLRNLNPRYLSPQQVADLVETFNLDLPSLGDHEGHDHG