Protein Info for SM_b20659 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 278 to 299 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 96 to 303 (208 residues), 66.5 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_4369)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TX7 at UniProt or InterPro

Protein Sequence (310 amino acids)

>SM_b20659 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MSSITPSGKPSTTASLMQNNNVLGFLFMLPAAVFLICFLTYPLGLGVWLGFTDTRIGRDG
VFIGIENYEFLARDSVFWLSVYNTLLYTFVASILKFVLGLWLALLLNENLPFKSFFRAIV
LLPWVVPTVLSALAFWWIYDSQFSIISWSLMQLGIIDGPINFLGDPNNARASVIAANVWR
GIPFVAISLLAGLQTIPASLQEAASLDGATSWQRFRYVTLPMLTPIIAVVMTFSVLFTFT
DFQLIYVLTKGGPVNATHLMATLSFQRGIPGGQLGEGAAIAVAMIPFLLAAIMFSFFGLQ
RRKWQQGGQD