Protein Info for SM_b20632 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 115 to 141 (27 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 192 to 215 (24 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 274 (178 residues), 76.3 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 99% identity to smk:Sinme_4199)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TH4 at UniProt or InterPro

Protein Sequence (287 amino acids)

>SM_b20632 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MRTRREIRARKALRDRIVYHGIGIGTAFFFLAPFAVSFLASFRPNSESGRPPLPPWPISG
LSFDAYRALDSFGAGIWQHMFNSLIVSIGTVVLTVAVSVLAGYGFSRYRFPFKNALFVLI
IATLMIPFQSILTPLFIILARFGLNNSLVGLMLVYVTLQLPFSVFMMRNAFDAVPKEIEE
AARIDGARDLKLLVRVLLPLVMPGIATVSIFAFLNAWNEFFAALVLLSSNDNYTLPVLMT
AVRAGRLGAINWGAVQAGVAVMVVPCLFVFLLLQRYYMRGLMAGAVK