Protein Info for SM_b20621 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 134 to 149 (16 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 296 to 313 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 23 to 306 (284 residues), 138.8 bits, see alignment E=1e-44

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_4209)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TI5 at UniProt or InterPro

Protein Sequence (318 amino acids)

>SM_b20621 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MLLAGMVLYFSLVTGGFASPQSAVFILQSVSITGILALGVTATLVVGGFDLSIGSVATTA
MMASSYVMVVMGGGALTAALVCLAVGALVGLINGFIIVYMRVPDLLATLGMMFLLLGLQR
IPTEGRSIAAGMTLPDGSVATGTFSPAFLALGRHRFDLVLPNLVPVSVVVLVVLAIAIWF
FLEYTRFGRIMYAVGSNERAAALAGAPVNAYKISAYVISGVFASIGGILLAARLGRGDIA
SGNNLLLDAVAAALIGFAVLGAAKPNAFGTAVGALFVGILLQGLTMMNAPYYTQDFIKGA
VLVVALIFTFALSKRGKR