Protein Info for SM_b20618 in Sinorhizobium meliloti 1021

Annotation: thiamine-phosphate pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00693: thiamine-phosphate diphosphorylase
  • amino acids 12 to 191 (180 residues), 163 bits, E=2.6e-52
• PF02581: TMP-TENI
  • amino acids 12 to 180 (169 residues), 166.5 bits, E=2e-53

Best Hits

Swiss-Prot: 73% identical to THIE_RHIEC: Thiamine-phosphate synthase (thiE) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00788, thiamine-phosphate pyrophosphorylase [EC: 2.5.1.3] (inferred from 100% identity to sme:SM_b20618)

MetaCyc: 52% identical to thiamine phosphate synthase (Escherichia coli K-12 substr. MG1655)
Thiamine-phosphate diphosphorylase. [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]; 2.5.1.3 [EC: 2.5.1.3]

Predicted SEED Role

"Thiamin-phosphate pyrophosphorylase (EC 2.5.1.3)" in subsystem Thiamin biosynthesis (EC 2.5.1.3)

MetaCyc Pathways

• thiamine diphosphate biosynthesis III (Staphylococcus) (2/3 steps found)
• thiamine diphosphate biosynthesis IV (eukaryotes) (2/3 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (1/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (1/2 steps found)
• thiamine diphosphate salvage II (3/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)
• thiamine diphosphate salvage V (1/3 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)
• superpathway of thiamine diphosphate biosynthesis I (5/10 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.3

Use Curated BLAST to search for 2.5.1.3

Sequence Analysis Tools

See Q92TI7 at UniProt or InterPro

Protein Sequence (201 amino acids)

>SM_b20618 thiamine-phosphate pyrophosphorylase (Sinorhizobium meliloti 1021)
MKLDPFYLIVDSAQWIERLVPLGVKLVQLRIKDRNEEDIRHQIRVARTVCSAHACQLIVN
DYWQLAIEEACDFIHLGQEDLAEADLAAIRAAGLKLGVSTHDEAELAKALAAEPDYVALG
PIYPTILKKMKWAPQGLERLSWWRERVHPLPLVAIGGLNTERIEGVFAHGADSAAVVTDI
TLNADPEGRTREWIRKTEAWR