Protein Info for SM_b20597 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details PF07291: MauE" amino acids 10 to 89 (80 residues), 33.6 bits, see alignment E=6.7e-12 PF07681: DoxX" amino acids 12 to 92 (81 residues), 69.7 bits, see alignment E=3.9e-23

Best Hits

Swiss-Prot: 39% identical to YQJF_ECOLI: Inner membrane protein YqjF (yqjF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4234)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TK3 at UniProt or InterPro

Protein Sequence (139 amino acids)

>SM_b20597 hypothetical protein (Sinorhizobium meliloti 1021)
MSDNPALQSSLALIGRLLLAAMFILSGFGKLGDPSGTIGYIASAGLPLPPVAYAVALAVE
IGAGILLVLGYRARWVALILAAFTLASAIGFHTDFADQNQMIHFMKNLAITGGFLQIAAF
GAGAFSLDGWTVRANREMS