Protein Info for SM_b20585 in Sinorhizobium meliloti 1021

Annotation: gamma-glutamyltranspeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR00066: gamma-glutamyltransferase" amino acids 38 to 554 (517 residues), 577.1 bits, see alignment E=1.6e-177 PF01019: G_glu_transpept" amino acids 47 to 567 (521 residues), 581.5 bits, see alignment E=9.4e-179

Best Hits

Swiss-Prot: 64% identical to GGT_PSEUA: Glutathione hydrolase proenzyme (ggt) from Pseudomonas sp. (strain A14)

KEGG orthology group: K00681, gamma-glutamyltranspeptidase [EC: 2.3.2.2] (inferred from 100% identity to sme:SM_b20585)

MetaCyc: 52% identical to glutathione hydrolase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Gamma-glutamyltranspeptidase (EC 2.3.2.2)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Utilization of glutathione as a sulphur source (EC 2.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TL4 at UniProt or InterPro

Protein Sequence (581 amino acids)

>SM_b20585 gamma-glutamyltranspeptidase (Sinorhizobium meliloti 1021)
MRSPCLKSLSITLIVALSTFAPRQGLAASPEPVKAEHGMVVTAQHLASDIGVEVLKKGGN
AIDAAVAVGYALAVVYPTAGNIGGGGFMTIRFKDGKTTFLDFRERAPLAATKTMYLDDKG
DLVKGLSTEGYLAVGVPGPVMGFEFARSRYGTKPLKELIDPAIELAREGFVLQQGDIESF
DGETERLARDPAAAAIFLKPDGKPFAAGDRLVQTDLAASLSSIAEKGTDAFYKGAIADAI
VKASADKGGILAKEDFERYQVRELEPVKCNYRGYDIVSSPPPSSGGLIICEILNILEGYP
LSYLGYGSAETVHAMIEAMRHAYVDRNTALGDPAFVENPVAKLVDKSYAKEIRAKIDPFK
AGVSQELMPAGFTESKETTHYSIIDDEGNAVAVTYTLNGSFGAGVVAPGTGILLNNEMDD
FTAKPGTPNLYGLVQGEANAIEPGKTPLSSMSPTIISRDGKPFMVIGSPGGARIITITLE
AIINVIDHGMNIQEAVDAPRVHHQWLPDKVFMEPYALSPDTRKLLSAMGHDVQVDENWMI
WGQAAGILVGGENVAEIEAGGGARYNGAVDSRIGAGAARGY