Protein Info for SM_b20577 in Sinorhizobium meliloti 1021

Annotation: protocatechuate 3,4-dioxygenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF12391: PCDO_beta_N" amino acids 19 to 52 (34 residues), 57.5 bits, see alignment 8.8e-20 TIGR02422: protocatechuate 3,4-dioxygenase, beta subunit" amino acids 26 to 248 (223 residues), 363.9 bits, see alignment E=1.5e-113 PF00775: Dioxygenase_C" amino acids 56 to 240 (185 residues), 197.6 bits, see alignment E=1.4e-62

Best Hits

Swiss-Prot: 61% identical to PCXB_PSEPU: Protocatechuate 3,4-dioxygenase beta chain (pcaH) from Pseudomonas putida

KEGG orthology group: K00449, protocatechuate 3,4-dioxygenase, beta subunit [EC: 1.13.11.3] (inferred from 100% identity to sme:SM_b20577)

MetaCyc: 61% identical to protocatechuate 3,4-dioxygenase beta subunit (Pseudomonas putida)
Protocatechuate 3,4-dioxygenase. [EC: 1.13.11.3]; 1.13.11.- [EC: 1.13.11.3]

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TM2 at UniProt or InterPro

Protein Sequence (253 amino acids)

>SM_b20577 protocatechuate 3,4-dioxygenase subunit beta (Sinorhizobium meliloti 1021)
MPDNQNGRRNGKPETGAFFARDRAWHPPAFAPGYKTSVLRSPQKALLSLDGTISEITGPV
FGHSMLGELDNDLIHNFASPGESAIGERIIVHGRVLDERGHPVHGVLVEFWQANAGGRYR
HKKESYLAPLDPNFGGCGRTITDEEGRYWFRTVRPGAYPWPNGVNDWRPAHIHFSVFGHG
FAQRLITQMYFEGDPMIWKCPIVGTVPDRRAIEQLIAALDWGNTVPMDARAYRFDIVLRG
RRSTFFENRPEGN