Protein Info for SM_b20573 in Sinorhizobium meliloti 1021

Annotation: NADH-dependent FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 4 to 149 (146 residues), 101.2 bits, E=2.1e-33
• TIGR03566: FMN reductase
  • amino acids 5 to 177 (173 residues), 252.3 bits, E=1.1e-79

Best Hits

Swiss-Prot: 42% identical to SFNF_PSEPF: NADH-dependent FMN reductase SfnF (sfnF) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 100% identity to sme:SM_b20573)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (30/33 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (3/3 steps found)
• two-component alkanesulfonate monooxygenase (1/2 steps found)
• bacterial bioluminescence (4/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.29

Sequence Analysis Tools

See Q92TM6 at UniProt or InterPro

Protein Sequence (185 amino acids)

>SM_b20573 NADH-dependent FMN reductase (Sinorhizobium meliloti 1021)
MPQTRVVGISGNITRPSRTRAFVDHIVHRLAVDAGASAQTFDIEDFGASLLPARRLDELA
PEARYVVGQILAADILVVASPTFKGSYTGLFKHVFDLLDPSSLRGKPVILAATGGGERHS
LMVEHQLRPLFGFFEALAMPTAIYASDKDFADGALASEAIHARVGRAVGEATQALARAAR
ASLAA