Protein Info for SM_b20568 in Sinorhizobium meliloti 1021

Annotation: amino acid ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 35 to 377 (343 residues), 224.8 bits, see alignment E=3.8e-70 PF13433: Peripla_BP_5" amino acids 36 to 376 (341 residues), 97.8 bits, see alignment E=1.1e-31 PF01094: ANF_receptor" amino acids 84 to 336 (253 residues), 36.4 bits, see alignment E=4.8e-13

Best Hits

Swiss-Prot: 84% identical to LIVB6_BRUME: Leu/Ile/Val-binding protein homolog 6 (BMEII0633) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to sme:SM_b20568)

Predicted SEED Role

"Leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TN0 at UniProt or InterPro

Protein Sequence (403 amino acids)

>SM_b20568 amino acid ABC transporter substrate-binding protein (Sinorhizobium meliloti 1021)
MPAGSSGRRGGRKYEKDHSGALAALATSVAAQADTIKVGVVGPFSGPFALQGKNFKAGID
AYMAVNGAKVGDDDIEIIYRDVPQADPAQSKALAQELVVKEGVQYLAGFYFTPDAMAVTP
LLEQANVPLVIMNAATSAIVTKSPLVVRTSFTLWQTSTPIAKVAKDAGVSKIISVVSDYG
PGVDAENAFKAGFEAAGGEIVEAIRMPLSTNDFSPIMQRIKDSGAEGVFAFLPSGPTTLG
FVKSFNENGLKDGGIKFFAPGDLTQESDLPALGDAALGLQTTFHYAVSHDSPENKAFVEA
AGKAIGNPAELSFPAVGAYDGMHVIYKMIEATGGEQDAQKAVDAVKGLSWTSPRGPVSID
PESRHITQNIYLREVAKADDGTYYNKEIQTFEKQGDPGLAAVK