Protein Info for SM_b20535 in Sinorhizobium meliloti 1021

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20535)

Predicted SEED Role

"Hydroxypyruvate reductase (EC 1.1.1.81)" in subsystem Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 1.1.1.81)

MetaCyc Pathways

photorespiration I (8/9 steps found)
photorespiration III (8/9 steps found)
photorespiration II (8/10 steps found)
L-serine biosynthesis II (3/4 steps found)
L-arabinose degradation IV (5/8 steps found)
D-xylose degradation IV (3/7 steps found)
formaldehyde assimilation I (serine pathway) (7/13 steps found)
superpathway of pentose and pentitol degradation (21/42 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.81

Use Curated BLAST to search for 1.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92W31 at UniProt or InterPro

Protein Sequence (336 amino acids)

>SM_b20535 dehydrogenase (Sinorhizobium meliloti 1021)
MTLPTVAFAMQPERTRYVLTPELLAQVDAFARILDQRPMTEFADEWSQRLLAEAQILVTG
WGAPFIDAAVLARAPRLRLIVHAAGTIKGLVDESVFDAGIRVSHAAEANAVPVAEFTLAA
VIFAGKQVFRFRDVYAADRGRERTQILQGEAVGNHRRTVGIVGASRIGRRVIGLLRHLDY
RLLLYDPLVKDAEAMALEVEKVDLDTLMARSDIVSLHAPLLPETRHMIDNRQLALMKDGA
TLINTARGALVDEAALIEKLQSGAINAVIDVTDPEIPDENSPLYDLPNVFLTPHIAGAIG
LERMRLGEMAVDEVARFLEGRPLLFEVHKQDLGRMA