Protein Info for SM_b20532 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details PF06532: NrsF" amino acids 10 to 212 (203 residues), 181.8 bits, see alignment E=7.7e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20532)

Predicted SEED Role

"EXTRACYTOPLASMIC FUNCTION ALTERNATIVE SIGMA FACTOR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92W34 at UniProt or InterPro

Protein Sequence (212 amino acids)

>SM_b20532 hypothetical protein (Sinorhizobium meliloti 1021)
METQELIKALAADNQRSGMPMTLVWTGAAVIAIALAACVFFVLLGPRPDITSAMQTLRFP
FKIVVAIALAASSLSALRALSRPETEPRDLLPPLIVAPALIAIAVLTELIAMPASTWSAR
LVGTNSLVCLSFIPLIGIGPLALLLLALRYGASSHPAVSGAAAGLAAGGIAAAFYASHCT
DDSPLFVATWYTMAVAILAIAGALAARRVIHW