Protein Info for SM_b20523 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 57 (24 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 222 to 381 (160 residues), 118.2 bits, see alignment E=1.5e-38 PF00990: GGDEF" amino acids 223 to 377 (155 residues), 122.8 bits, see alignment E=6.1e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20523)

Predicted SEED Role

"hypothetical protein TRANSMEMBRANE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92W41 at UniProt or InterPro

Protein Sequence (402 amino acids)

>SM_b20523 hypothetical protein (Sinorhizobium meliloti 1021)
MGGAISLLAVNFIVAQIFVVAFLIISVKSRSGRAAAWCAAGFAVASLSAICEAVLPFTPM
PRLFAVGAFANVLAGFCLLRIGLGVFYSVPAKPPVLASFFIGSVIVDLFIYDLPRGTLLH
AFFYQMPFFLIQAWSAAAIIRSRRRSYADGILLCMLALSALYFLVKIYAAVAAGSGATAA
DYLQSPFALISQALGAMLIVGTGVAMLGVVVKDVVDEARASSEIDALSGLCNRRGFSSRV
APLLRDLSDHDVGTLILADIDRFKLVNDTFGHHTGDEVIREFSHILADVMPHRAVAGRVG
GEEFAIFLPRVGLADARVVANGIRSELAVKRINGLPEGVAVTASFGVSAVAAGELLDAAM
RRADNSLYAAKAGGRNRVECAEPPIRVIASADYHRSGKYRPT