Protein Info for SM_b20490 in Sinorhizobium meliloti 1021

Annotation: L-fuculose phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF00596: Aldolase_II" amino acids 13 to 186 (174 residues), 178.1 bits, see alignment E=8.3e-57

Best Hits

Swiss-Prot: 48% identical to ALD2_RHORT: 5-(methylthio)ribulose-1-phosphate aldolase (ald2) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 99% identity to smk:Sinme_3701)

MetaCyc: 48% identical to 5-(methylthio)ribulose-1-phosphate aldolase (Rhodospirillum rubrum)
RXN-21316 [EC: 4.1.2.62]; 4.1.2.62 [EC: 4.1.2.62]

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.17

Use Curated BLAST to search for 4.1.2.17 or 4.1.2.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92W73 at UniProt or InterPro

Protein Sequence (232 amino acids)

>SM_b20490 L-fuculose phosphate aldolase (Sinorhizobium meliloti 1021)
MAETETDKLALRREMVDICRRMNLSGINQGTAGNLSVRTDDGFLITPSSMPYDTMQPDDL
VEMGFDGTYVGHRPSSEWRFHRDILRARTDIDVVLHCHSIYATTLACHHKTIPSFHYMTG
IAGGTTIRCAEYATFGTQALSDNALLALKDRLACLLGQHGQISLGKTLEQALWLAIEVET
LSRIYVQALTLGEPPILPDDEMERVIAQMRRMSYGQAPDPEGVNDVARPRVS