Protein Info for SM_b20446 in Sinorhizobium meliloti 1021

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 TIGR00695: mannonate dehydratase" amino acids 1 to 393 (393 residues), 498.4 bits, see alignment E=8.2e-154 PF03786: UxuA" amino acids 1 to 391 (391 residues), 389.5 bits, see alignment E=1.2e-120 PF01261: AP_endonuc_2" amino acids 169 to 333 (165 residues), 35.7 bits, see alignment E=8e-13

Best Hits

Swiss-Prot: 100% identical to UXUA_RHIME: Mannonate dehydratase (uxuA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01686, mannonate dehydratase [EC: 4.2.1.8] (inferred from 100% identity to sme:SM_b20446)

MetaCyc: 53% identical to D-mannonate dehydratase (Escherichia coli K-12 substr. MG1655)
Mannonate dehydratase. [EC: 4.2.1.8]

Predicted SEED Role

"Mannonate dehydratase (EC 4.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WB5 at UniProt or InterPro

Protein Sequence (402 amino acids)

>SM_b20446 mannonate dehydratase (Sinorhizobium meliloti 1021)
MRHTWRWFGPVDRVSVQDAAQAGAHGIVSALHHIPTGDVWPVDEIGKRQEEVRAGGLEWE
VVESVPVSECIKTQTGPWREHVANWQETLRRLSAAGIRTVCYNFMPVLDWTRTDLRWTAR
HGAKAMRFDRIDFAAFDIHLLERPAAHEDYDTATREAAERRFREMTEERRLALSRNIGAG
LPGSADGYSLPQLREHLRTYDGVSREKLQRHLVEFLAEVAPVAERTGINICAHPDDPPWA
LLGLPRILSNAEDYAFMLREVDSPANGVTLCTGSLGALAANDLPAMTRQFASRIHFVHLR
NVLREEVRTPCSFYEDEHLEGDTDMVAVIAELLQEEQRRRAAGRVDHQIPMRPDHGQEIL
DDLSRGAQPGYPAIGRLKGLAELRGIERALSHATYGLSAATR