Protein Info for SM_b20444 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 165 to 192 (28 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 257 to 296 (40 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 353 to 384 (32 residues), see Phobius details amino acids 396 to 422 (27 residues), see Phobius details amino acids 435 to 460 (26 residues), see Phobius details PF06808: DctM" amino acids 5 to 248 (244 residues), 239.6 bits, see alignment E=3e-75 amino acids 255 to 455 (201 residues), 223.1 bits, see alignment E=3e-70

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_3740)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WB7 at UniProt or InterPro

Protein Sequence (468 amino acids)

>SM_b20444 hypothetical protein (Sinorhizobium meliloti 1021)
MLLLVGSFLVLMLVGVPVAISMAAASVLYLVSYNVAPDIIAAQRMIAGVESFPLLAVPFF
ILAGNLMNSAGVTGRIYSFAVALVGWMKGGLAQVNIVGSVIFSGMSGTALADAAGIGTIE
IKAMKDHGYPVDAAVGVTAASATLGPIFPPSLPFVIYGMMANVSIGALFMAGVVPGVVMT
VLMMLTVAIFAYKRGWGSDTPFEMKRLLAASLEVVVVLAVPLFIYLLMAAGLSMNLAVGI
ALVVLLALDWYFDFSAVMALMTPIILIGGMTMGWFTPTEAAVAAVIWSLFLGLVRYRTMT
MSTLARATFDTIETTASVLFIVTAASIFAWLLTVSQAAQMLSGAILTITDNKWVFLILVN
LLMLFVGCFLDTIAAITILVPILLPLTAQFGIDPVHFGLIMTLNLMIGLLHPPLGMVLFV
LSRVAKLSVERTTMAILPWLVPLFIALILITFVPAVVLWLPQSVGLIR