Protein Info for SM_b20429 in Sinorhizobium meliloti 1021

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details TIGR03004: ectoine/hydroxyectoine ABC transporter, permease protein EhuC" amino acids 5 to 218 (214 residues), 374.2 bits, see alignment E=2.3e-116 TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 9 to 105 (97 residues), 91.3 bits, see alignment E=4.7e-30 PF00528: BPD_transp_1" amino acids 31 to 211 (181 residues), 78.2 bits, see alignment E=3.6e-26

Best Hits

Swiss-Prot: 36% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to smk:Sinme_3751)

MetaCyc: 36% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WC7 at UniProt or InterPro

Protein Sequence (219 amino acids)

>SM_b20429 amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MIDWSGYIGLILQGAWVTVQLTLMGSALAVVVAFAAGLGRLSRFMAVRALATTYIEFFRG
TSIFVQLFWVYFVLPFAGITLTPLQAGVLALGLNVGAYGAEVVRGAVKAIGREQREACIA
LNLTRFQAMRHIVLPQALPLMLPTFGNNAIELLKGTAVVSLISLSDMTFQAQVVRAQTGS
TLIPFATILLLYFVMAWLISLGMRWLERRVSRGLDGVRV