Protein Info for SM_b20427 in Sinorhizobium meliloti 1021

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR03005: ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA" amino acids 6 to 256 (251 residues), 493.5 bits, see alignment E=4.9e-153 PF00005: ABC_tran" amino acids 21 to 178 (158 residues), 123 bits, see alignment E=2.1e-39

Best Hits

Swiss-Prot: 61% identical to Y4TH_SINFN: Probable amino-acid ABC transporter ATP-binding protein y4tH (NGR_a01510) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3753)

Predicted SEED Role

"ABC-type polar amino acid transport system, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WC9 at UniProt or InterPro

Protein Sequence (261 amino acids)

>SM_b20427 amino acid ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MSQPIIRIDNIVKRYGPLTVLDGLSMEVMPGEKLALIGPSGSGKTTILRILMTLETISDG
FIQVDGEQLYHMKKAGSLVPADERHLHKMREKIGMVFQHFNLFPHKCVLDNVTLAPMLTK
GMARAQAEKRAMELLDMVGLADKAKSMPAQLSGGQKQRVAIARALALSPKIMLFDEVTSA
LDPELVEEVLNVMRKLASETDMTMLLVTHEMGFAHDFADRVLFFDRGKIVEEGKPEDIFR
HPKQERTQTFLRKIIAAGHRV