Protein Info for SM_b20424 in Sinorhizobium meliloti 1021

Annotation: succinate-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 53% identical to DOEC_HALED: Aspartate-semialdehyde dehydrogenase (Non-phosphorylating) (doeC) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K00135, succinate-semialdehyde dehydrogenase (NADP+) [EC: 1.2.1.16] (inferred from 100% identity to sme:SM_b20424)

MetaCyc: 53% identical to aspartate-semialdehyde dehydrogenase (non-phosphorylating) (Halomonas elongata DSM 2581)
1.2.1.M5 [EC: 1.2.1.M5]

Predicted SEED Role

No annotation

MetaCyc Pathways

ectoine degradation (4/4 steps found)
4-aminobutanoate degradation III (2/2 steps found)
L-canavanine degradation II (1/6 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.16

Use Curated BLAST to search for 1.2.1.16 or 1.2.1.M5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WD2 at UniProt or InterPro

Protein Sequence (498 amino acids)

>SM_b20424 succinate-semialdehyde dehydrogenase (Sinorhizobium meliloti 1021)
MTAVFARTAFHDALKNLSDRQLLRELAYVGGRWVAGRDGTCLEVSDPASGAALAFVASLD
AAQTSEAIDAAQKAFRSWHNMLPQARAAILRKWHDLMLEAREDLALLMTLEQGKPLAESR
GEIDYAASFIEWYAEEGKRLNAESVTSHLAGAEMIVRREALGVVGIVTPWNFPSAMITRK
AAAALAAGCTVVAHPSSETPLSALALAELGERAGLPAGVFNVVTGKAATIVGRMCEDARV
RAMSFTGSTEIGRLIASQCAPTMKRLVMELGGHAPLIVFADANVEKAADIAIAAKFATSG
QDCLAANRIYVERPALKAFQEAFAARIAGLKVGSGMEPDTDIGPLMHERAVAKVEEQVAD
ALKLGARLAVGGKRHAAGPLFFQPTLLTDVPDDALIMREETFGPVAAVTAFDSEEEVVAR
ANDTEYGLVAYVVTENGARQMRLARALEYGMVAVNRVKITGGPIPFGGWKQSGLGREGSR
HGMEAFTELKYLCIDTAA