Protein Info for SM_b20423 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00202: Aminotran_3
  • amino acids 30 to 448 (419 residues), 268.2 bits, E=5.4e-84

Best Hits

Swiss-Prot: 61% identical to DOED_HALED: Diaminobutyrate--2-oxoglutarate transaminase (doeD) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3757)

MetaCyc: 61% identical to diaminobutanoate--2-oxoglutarate transaminase (Halomonas elongata DSM 2581)

Predicted SEED Role

"Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19)" (EC 2.6.1.19)

MetaCyc Pathways

• 4-aminobutanoate degradation II (2/2 steps found)
• 4-aminobutanoate degradation III (2/2 steps found)
• superpathway of 4-aminobutanoate degradation (2/3 steps found)
• superpathway of L-arginine and L-ornithine degradation (9/13 steps found)
• 4-aminobutanoate degradation I (1/2 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (7/11 steps found)
• GABA shunt I (1/4 steps found)
• GABA shunt II (1/4 steps found)
• 4-aminobutanoate degradation V (3/7 steps found)
• nicotine degradation I (pyridine pathway) (5/17 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Butanoate metabolism
• Glutamate metabolism
• Propanoate metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.19

Use Curated BLAST to search for 2.6.1.19

Sequence Analysis Tools

See Q92WD3 at UniProt or InterPro

Protein Sequence (458 amino acids)

>SM_b20423 hypothetical protein (Sinorhizobium meliloti 1021)
MLERSNELTAWDRDHFFHPSTHMGMHARGETPTRVIGGGEGVYITDISGKRSLDAFAGLY
CVNVGYGRQKIADAIAEQAKNLAYYHAYVGHGTEASIRLSKMIIDRAPEGMSRVYFGLSG
SDANETNIKLIWYYNNILGRPEKKKIISRWRGYHGSGVMTGSLTGLHLFHNAFDLPRAPI
LHTEAPYYFRRPDRSMSEEQFSQYCADKLEEMILAEGPDTVAAFIGEPILGTGGIVPPPK
GYWEKIQAVLQKYDILLVADEVVTGFGRLGTMFGSDHYGIKPDLITIAKGLTSAYAPLSG
TIVSDKLWQVLVKGSDELGAIGHGWTYSAHPICAAAGIANLELIDELGIVENAGSTGAYF
RAELQKAVGDHRHVGEVRGDGLMAAIEFVEDRDDRAFFDPGRKVGPQVAAALLERGVIGR
AMPQGDILGFAPPLCLTRDEADIVVKAAADTIQSVLGR