Protein Info for SM_b20419 in Sinorhizobium meliloti 1021

Annotation: glycerol-3-phosphate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 PF00005: ABC_tran" amino acids 21 to 162 (142 residues), 119.5 bits, see alignment E=2.6e-38 PF08402: TOBE_2" amino acids 267 to 342 (76 residues), 39.5 bits, see alignment E=7.5e-14 PF03459: TOBE" amino acids 289 to 334 (46 residues), 22.4 bits, see alignment 1.8e-08

Best Hits

Swiss-Prot: 100% identical to UGPC_RHIME: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K05816, sn-glycerol 3-phosphate transport system ATP-binding protein [EC: 3.6.3.20] (inferred from 100% identity to sme:SM_b20419)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WD6 at UniProt or InterPro

Protein Sequence (349 amino acids)

>SM_b20419 glycerol-3-phosphate ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MATITLKDVHKTYHGDIAAIRGVSLAIADGEFIVLVGPSGCGKSTLLRMIAGLESITSGE
ISIGDRVVNGLEPSERDIAMVFQNYALYPHMTVRQNLSYGLKNRNTPKEEIERRIAKAAK
SLEIEPFLDRKPRQLSGGQRQRVAMGRAIVREPAAFLFDEPLSNLDAKLRVQMRVEIKRL
QRALGTTSVYVTHDQLEAMTLADRLVVLNGGRIEQVGTPIELYENPATAFVATFIGSPSM
NLLDLNTGNAAWSAPAALVGKPGLATIGIRPEDITLAGDTDGGERFRARVRVGAVELVGA
ESYVHGTLANGEPLVFRVAGRSRMMIDEEVEVAAVAGSLHWFDAAGRRL