Protein Info for SM_b20385 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20385)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WG8 at UniProt or InterPro

Protein Sequence (242 amino acids)

>SM_b20385 hypothetical protein (Sinorhizobium meliloti 1021)
MSSCQSNLPSNLTVSLRELRMVFERLIQVTRLDAGLVPSLRDCALYSAALGLGGFARLAH
NLEAVRSANPHALRLTADAERLIVDCGGQHAWIAADAVLDLAAERLRTQGSGRVEVRSAT
EIGELRVVEALAQRFRLQAEVAIDETAGSAEIVVSPARKGMDVTVLERIRRNGLTVDAAL
WWQLFHRSAEALAPDSYVSRRHAGPIIVEADGKVIGRQDEDETDLSLLIAGAAQHGTTAI
NN