Protein Info for SM_b20381 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 59 to 85 (27 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 82 to 247 (166 residues), 41.7 bits, see alignment E=5.4e-15

Best Hits

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 99% identity to smk:Sinme_3797)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WH2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>SM_b20381 ABC transporter permease (Sinorhizobium meliloti 1021)
MSVWIRSLAILIAAFVAAPMFIVIPMSFSSAASLAFPPPGYTLQNYVNFFSDPNWTQPLT
NSLLIGFGTVCVTMLVAVPASFALVRHVFIGRTVFNLLIMLPMIVPTIVMALGYYIYFGQ
LRLVQSYLGVILAHSCIALPMSTLILTAALKGFDRSVERAAMNLGASPFATFRLITFPIL
RPAFTVAGLFAFIASFDEAVIALFISGRDKATLPRQMFNAVRQEADPTISAASSFLFLLV
LAGVCIWLAPQLVRRRTRPLGQTDGNGAAEPAAAAS