Protein Info for SM_b20364 in Sinorhizobium meliloti 1021

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 742 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 261 to 283 (23 residues), see Phobius details amino acids 303 to 330 (28 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details amino acids 458 to 484 (27 residues), see Phobius details amino acids 527 to 547 (21 residues), see Phobius details amino acids 559 to 579 (21 residues), see Phobius details amino acids 587 to 605 (19 residues), see Phobius details amino acids 647 to 670 (24 residues), see Phobius details amino acids 691 to 715 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 240 to 425 (186 residues), 55.7 bits, see alignment E=2.8e-19 amino acids 538 to 713 (176 residues), 44.6 bits, see alignment E=7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20364)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WI9 at UniProt or InterPro

Protein Sequence (742 amino acids)

>SM_b20364 iron ABC transporter permease (Sinorhizobium meliloti 1021)
MKTHYRRLDIALALGLAAFVLLPWYRIDGGFFGFGWLSAFPEEPVAAPGLVQIASFGKWW
LMLPALAMMVAAAARFIGDPARRGSFLAWTGAGGIVVLALQGLAIGFSGWNWTVSEALFG
ALAEGQPSMGAGAVLAALVFVLIFAFGIAERGVMKGDAFVVSAISLLVFLVAVFVFYPVG
SMLVGAFQDFDGSFNPEGFTRNIVDPSIWSLDCVVGGGRCGIAWRTFWLAVMTAGGSTIL
GLAFALLATRTGFRYKRSLRLLTVLPIITPPFVVGLALTLLFGRSGVITEALSTLIGVEP
GRWLYGLTGIWIAQVLSFTPISFLVLIGVVEGVSPSMEEASQTLRADRWRTFWRISLPLM
KPGLANAFLIGFIESMADFGNPLVLGGSHGVLSTEIFFAVVGSQNDPSRAAVLAIILLCF
TLTAFLAQRFWLSGKNFATVTGKGDSGAHAALPRTVSIAVHVLVIPWALFTLVVYGMILV
GGFVRTWGLDNSLTLAHYIKAFSVEIRDGGIAWTGVAWNSFWTTMEIALISAPLTAAVGL
LTAYLIVRQRFAGRELFEFALMMSFAIPGTVIGISYIMAFNLPPLEITGSALILVACFVF
RNMPVGVRGGVAAMSQLDRSLDEASLTLRADSFRTIRKVILPLLRPAITAALVYSFVRAV
TSISAVIFLVSAEYNMATAYIVGLVENGEYGVAIAYSSMLIVVMISVIAGFQLVVGERRL
RRENRVQAVARAPVPLPQEKTA