Protein Info for SM_b20361 in Sinorhizobium meliloti 1021

Annotation: ionic voltage-gated channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 123 (30 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details PF00520: Ion_trans" amino acids 40 to 226 (187 residues), 39.4 bits, see alignment E=4.1e-14 PF07885: Ion_trans_2" amino acids 158 to 227 (70 residues), 46.2 bits, see alignment E=3.5e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20361)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WJ2 at UniProt or InterPro

Protein Sequence (265 amino acids)

>SM_b20361 ionic voltage-gated channel protein (Sinorhizobium meliloti 1021)
MDMTDQPRAHSKLNSTRLALQRLERGRDPWALRWQALLAVIDLSILAFFILGPYLRAGPS
YLIIDYIIAAWIGCELIARAFAAPSIERFLRRPMTWVDVIILGTLLFPDLLFNFAFLRVM
RIWAIGKSPLLLEGLRRAGWSHLQDVFRACLNFLVFLFVVTGFVYTTFFYHREGGEGFVD
ALYFTVATITTTGFGDITLPGTLGKLTSVITMIVGISLFVRLAQAVVRPYKVSFPCPQCG
LQRHDTDAVHCKACGHLLNIPDEGD