Protein Info for SM_b20353 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 6 to 121 (116 residues), 80.5 bits, see alignment E=1.7e-26 PF02894: GFO_IDH_MocA_C" amino acids 135 to 339 (205 residues), 58.2 bits, see alignment E=1.1e-19

Best Hits

Swiss-Prot: 68% identical to APSD_AGRRK: D-apiose dehydrogenase (apsD) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_3825)

MetaCyc: 68% identical to D-apiose dehydrogenase (Agrobacterium radiobacter K84)
RXN-20931 [EC: 1.1.1.420]

Predicted SEED Role

"putative oxidoreductase protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.420

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WK0 at UniProt or InterPro

Protein Sequence (344 amino acids)

>SM_b20353 oxidoreductase (Sinorhizobium meliloti 1021)
MTDLKGALIGCGFFAVNQMHGWRDAEGARIVAICDRDPERLKAVGDAFGIQRRYTSAEDL
FADGGFDFVDIATTVGSHRGLVEMAARHGVATICQKPIAPTMEDAKAMVSACAKSGVAFM
VHENFRWQSPIRAVKAAIDSGAIGEVFWGRVSFRSGYDVFSGQPYLATGKRFIIEDLGIH
ALDVARYIFGDATAVTARTRRVNPAIAGEDVATMLLDHDGGITSLVDCSYATKLPIEPFP
ETLMEVDGSKGTLRLTQGYHLAVHSKGATKLTNVEPPALSWASPPWHNIQESVALIQQHW
IEALRAGREPDTSGRDNLETFALVEASYLSAAEGRTVSLAEVLG