Protein Info for SM_b20352 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 108 to 133 (26 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 276 to 283 (8 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 317 to 334 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 60 to 332 (273 residues), 151.2 bits, see alignment E=1.7e-48

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to smk:Sinme_3826)

MetaCyc: 51% identical to putative erythritol ABC transporter membrane protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WK1 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SM_b20352 sugar ABC transporter permease (Sinorhizobium meliloti 1021)
MTTATTTTNATDATSGSVLLTLMKLRTFIALFAVVAFFSIFAPNFLSTANLILMSKHVAL
NAFLAMGMTFVIITGGIDLSVGSIVGLCGMVAGGLILNGIDLQFGYTVYFNVVEVCLITL
AVGIVIGAVNGLLITKLNVAPFIATLGTLYVARGFALLSSGGQTFPNLVGKPELATTGFA
FLGSGRLLGLPVSIWVLIVVALAAAYVARYTPIGRHIFAVGGNERAARMSGIRVDRVKMF
VYMFSGFCAAIVGLVISSELMASHPATGNSFELNAIAAAVLGGTSMSGGRGTIGGTIIGA
FVIGILSDGLVMMGISSFWQMVIKGIVIIVAVVVDQAQRRLQQQVTLMQLAKKG