Protein Info for SM_b20349 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 30 to 284 (255 residues), 205.4 bits, see alignment E=1.8e-64 PF00532: Peripla_BP_1" amino acids 30 to 236 (207 residues), 72.8 bits, see alignment E=5e-24 PF13377: Peripla_BP_3" amino acids 163 to 293 (131 residues), 27.6 bits, see alignment E=4.3e-10

Best Hits

Swiss-Prot: 31% identical to RBSB_HAEIN: Ribose import binding protein RbsB (rbsB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 99% identity to smk:Sinme_3829)

MetaCyc: 48% identical to putative erythritol ABC transporter substrate-binding protein (Brucella abortus 2308)
7.5.2.-

Predicted SEED Role

"Ribose ABC transport system, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WK4 at UniProt or InterPro

Protein Sequence (313 amino acids)

>SM_b20349 sugar ABC transporter (Sinorhizobium meliloti 1021)
MKLTRRMTITAFAAVLAASSAVPAYAADLIAIITPSHDNPFFKAEAVGAEAKAKELGYET
LVLVHDDDANKQSQLIDTAIGRGAKAIILDNAGSEASIAAVQKAKDAGVPSFLIDREINA
TGVAVSQIVSNNYQGAQLGAEEFVKLMGESGNYVELLGREADLNAGIRSKGYHDVIDEYP
EMKMVAQQSANWSQTEGYSKMETILQANPDIKGVISGNDTMAMGAIAALQAAGRKDVIVV
GFDGSNDVRDSIKSGGIKATVLQPAYAQAQMAVQQAHEYITTGKAPAEEKQLMDCVLINS
ENADQLETFALAD