Protein Info for SM_b20348 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF03446: NAD_binding_2" amino acids 4 to 90 (87 residues), 28.8 bits, see alignment E=2.4e-10 PF03807: F420_oxidored" amino acids 4 to 89 (86 residues), 32.2 bits, see alignment E=2.6e-11 PF07991: KARI_N" amino acids 4 to 88 (85 residues), 29.1 bits, see alignment E=1.4e-10 PF16896: PGDH_C" amino acids 121 to 275 (155 residues), 256.7 bits, see alignment E=1.5e-80

Best Hits

Swiss-Prot: 83% identical to APNO_AGRRK: D-apionate oxidoisomerase (apnO) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20348)

MetaCyc: 83% identical to D-apionate oxidoisomerase (Agrobacterium radiobacter K84)
RXN-20933 [EC: 1.1.1.421]

Predicted SEED Role

"FIG00553873: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.421

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WK5 at UniProt or InterPro

Protein Sequence (275 amino acids)

>SM_b20348 hypothetical protein (Sinorhizobium meliloti 1021)
MTSIALFGAGGKMGCRLAKNLKGSRFDVRHVEVSEAGKTRLADELGLQAVAADEALDGAE
VVILAVPDTAIGKVASGIVDRLKSGTMVIVLDAAAPYAGHLPERGDLTYFVTHPCHPPIF
NDETDAAAKRDFFGGVAAKQHIVSALMQGPEEAYALGEEIAKIIWAPVMRSHRVTVEQIA
LLEPGLSETVCASLLVVMREAMEECVKRGVPKQAARDFLLGHMNVLGAVIFEETPGVFSD
ACNKAIEFGKPMLMREDWKRVFEPQEIADSIRRIT