Protein Info for SM_b20327 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-trehalose/D-maltose/sucrose, permease component 2 (ThuG)
Rationale: Specific phenotype on trehalose, but also reported to transport maltose and sucrose (PMID:12003938; also PMC1635973)
Original annotation: trehalosemaltose transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 266 (182 residues), 42.9 bits, see alignment E=2.4e-15

Best Hits

Swiss-Prot: 48% identical to MALG_THELN: Trehalose/maltose transport system permease protein MalG (malG) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: K10238, trehalose/maltose transport system permease protein (inferred from 100% identity to sme:SM_b20327)

MetaCyc: 44% identical to ABC-type trehalose transporter integral membrane protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANS0 at UniProt or InterPro

Protein Sequence (276 amino acids)

>SM_b20327 ABC transporter for D-trehalose/D-maltose/sucrose, permease component 2 (ThuG) (Sinorhizobium meliloti 1021)
MVVAIAKRTAFYALVAVIILVAVFPFYYAILTSLKSGTALFRIDYWPTDISLANYAGIFS
HGTFVRNLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVL
AGLFELIRFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWVV
ITRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPW
GNIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVKG