Protein Info for SM_b20326 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for D-trehalose/D-maltose/sucrose, permease component 1 (ThuF)
Rationale: Specific phenotype on trehalose, but also reported to transport maltose and sucrose (PMID:12003938; also PMC1635973)
Original annotation: trehalosemaltose transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 294 to 318 (25 residues), see Phobius details PF00528: BPD_transp_1" amino acids 119 to 319 (201 residues), 61.2 bits, see alignment E=5.5e-21

Best Hits

KEGG orthology group: K10237, trehalose/maltose transport system permease protein (inferred from 100% identity to sme:SM_b20326)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANS1 at UniProt or InterPro

Protein Sequence (328 amino acids)

>SM_b20326 ABC transporter for D-trehalose/D-maltose/sucrose, permease component 1 (ThuF) (Sinorhizobium meliloti 1021)
MTDLSLADRPAALAHGGRIGSDLQAQRVRSAWLFLAPTFLVLALVAGWPLIRTIYFSFTN
ASLTNLSGAEFVGFANYLSWITLKSGRTIYRGLLADPAWWNAVWNTLKFTVLSVSIETAL
GLIVALVLNAQFPGRGLVRAAILIPWAIPTIVSAKMWAWMLNDQFGILNDMLIGLGLIGE
KIAWTASPDTAMIAELIVDVWKTTPFMALLILAGLQMVPGDIYEAAKIDGVHPVRVFWRV
TLPLIRPALMVAVIFRMLDALRIFDLIYVLTPNNAQTKTMSVMARENLFDFDKFAYGAAA
STMLFLIIATITILYMWLGRLNLSGGER