Protein Info for SM_b20315 in Sinorhizobium meliloti 1021

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 48 to 77 (30 residues), see Phobius details amino acids 97 to 125 (29 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 219 to 239 (21 residues), see Phobius details amino acids 248 to 265 (18 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 312 (270 residues), 94.2 bits, see alignment E=4e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20315)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WN1 at UniProt or InterPro

Protein Sequence (328 amino acids)

>SM_b20315 sugar ABC transporter permease (Sinorhizobium meliloti 1021)
MKSVFADRQFNFLVATNVLVVALAVVFAGETFLSLYNFQSMSAQVPELALLALGVMLAMI
AGGGGIDLSGIALANLAGVGSYLLVRDWVSADEAPLAFSWLFAAMALLIGLAGGLLNGAL
IAFAGLTPIIATLGTQLFFTGLAVAFTNGSAITLGYIEPLDNFGNTPVLGVPMCFTLFVV
IAALIGVVLRFTPFGFKLYLMGSNAKAARYAGIPQRRMLLLTYTVCGVLASIAGIIIAAR
TSSVKWDYGSSYVLIAILIVVMAGVRPDGGYGRTVCVVLSATALQMLSSLFNFLDISNFF
RDCAWGLLLIVFLATSRVDLRAYLSPRR