Protein Info for SM_b20297 in Sinorhizobium meliloti 1021

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 44 to 66 (23 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 310 to 341 (32 residues), see Phobius details amino acids 353 to 377 (25 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details PF06808: DctM" amino acids 6 to 413 (408 residues), 397.4 bits, see alignment E=3.7e-123 TIGR00786: TRAP transporter, DctM subunit" amino acids 15 to 418 (404 residues), 455.6 bits, see alignment E=6.6e-141

Best Hits

Swiss-Prot: 61% identical to SIAM_VIBCH: Sialic acid TRAP transporter large permease protein SiaM (siaM) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_3875)

MetaCyc: 37% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type transport system, large permease component, predicted N-acetylneuraminate transporter" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WP2 at UniProt or InterPro

Protein Sequence (426 amino acids)

>SM_b20297 permease (Sinorhizobium meliloti 1021)
MATLFGGWFALLIAGMPVGFTLIVAALAYMLWQGTGLNFAGQRMIAGLNSFPLLAVPFFI
LTAQLMNLSGVTERIFDFAKALVGHIRGGLGHVNIMASVLFSGMSGSAVADAAGLGQLEI
KAMRDAGYDEQFSGSITAASAIIGPLIPPSIPLVVYGVIANTSIGGLFLGGIVPGLLCAA
SLMIMVYVIAWRRNYATAQRAGFRRVWSTFWHALLPLITPFIIIGGIFAGVFSPTEAAVV
AASYALFLGVVVYREITFAKLVTVLRETVSHTAAVGLLIMGVSLFGYVIAREQVPQHVAT
FFLTYAEDPLTFLILVNLMLLALGTFIEALAILLLIVPVLVPTALQFGVDPVHFGVMVVF
NLMIGILTPPMGVALFVVSKVADIPFGVLARGILPLLIPLVVVLVLITIFPALVTFIPDQ
MLGAAR