Protein Info for SM_b20295 in Sinorhizobium meliloti 1021

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03480: DctP" amino acids 30 to 306 (277 residues), 253.8 bits, see alignment E=1.1e-79 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 31 to 284 (254 residues), 215.2 bits, see alignment E=5.3e-68

Best Hits

Swiss-Prot: 44% identical to SIAP_VIBCH: Sialic acid-binding periplasmic protein SiaP (siaP) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20295)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WP4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>SM_b20295 ABC transporter substrate-binding protein (Sinorhizobium meliloti 1021)
MKTGMISLALAGLLMASQAMAQEARTLRLGMQGTAGDPQFEGVTEAARIIKEKSGGRLTL
EIFPNSQLGTFTEMMEQVTLGELDFTLNPFGGMDAWVPRAVLASTAYVVGDFDHLQKIIA
SDWGKGIVDEMRTEHKWRMVDSWYFGTRHTTAKKPIEKPADFAGMKLRVPNSAPLLTWAK
AMGASPTPVAFAEVYLALQTNQVDGQENPLPIIDSMKFTEVQSHVSLTGHLVQDQVILMS
EDTWNALEPADQKVVMEAFEAGGALNDKLVSDKEANLVSDFRERGITVVEPDKAAFQEAM
KPVYADLDAKFGADTVKTLLDLR