Protein Info for SM_b20294 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator NanR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF00392: GntR" amino acids 11 to 73 (63 residues), 58.8 bits, see alignment E=3.5e-20 PF07729: FCD" amino acids 104 to 222 (119 residues), 89.2 bits, see alignment E=3e-29

Best Hits

Swiss-Prot: 48% identical to NANR_KLEAK: HTH-type transcriptional repressor NanR (nanR) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_3878)

Predicted SEED Role

"Transcriptional regulator NanR" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WP5 at UniProt or InterPro

Protein Sequence (233 amino acids)

>SM_b20294 transcriptional regulator NanR (Sinorhizobium meliloti 1021)
MSTLAVRKKLSDEVRLKLEEMIRDEIYPLGATLPSERDLMELFGVGRPSIREALYALERM
GLVKVSTGERAKVTRPTPDHFLSSLAGAARMLLGHPEGVANFEQARLFLEEGCARHLAAH
ATAEQIEAIDAALARNEAAIGKARAFAATDVAFHRTLTQMVSNPIFVAVHDAFVDWLIGQ
RPLPVRPEISNRESFEEHVAIVEAIRSRDPERAGRVMREHLESAARKYRQTSP