Protein Info for SM_b20292 in Sinorhizobium meliloti 1021

Annotation: immunogenic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 7 to 324 (318 residues), 346.2 bits, see alignment E=6.9e-108 PF16868: NMT1_3" amino acids 35 to 324 (290 residues), 330.6 bits, see alignment E=1e-102 PF09084: NMT1" amino acids 104 to 200 (97 residues), 23.7 bits, see alignment E=4.1e-09

Best Hits

KEGG orthology group: K07080, (no description) (inferred from 100% identity to sme:SM_b20292)

Predicted SEED Role

"TRAP transporter solute receptor, TAXI family precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WP7 at UniProt or InterPro

Protein Sequence (327 amino acids)

>SM_b20292 immunogenic protein (Sinorhizobium meliloti 1021)
MKHERITLRGAQIAALSAALFFSGGAAAQQKFVTIGTGGVTGVYYAAGGAICRLLNKDRK
SHGIRCSVESTGGSAFNVNTIKEGELDFGMAQSDVQYNAMKGEESFKEGGAHADLRAVFS
IHPEPFTVLAHPNAGVTKFEDFKGKRFNVGNPGSGTRASMERLLGAMGWTLADFSLASEL
KADEHGPALCDGKIDGFFYGVGHPSANIQDPTTTCAAKLVPLTGEVVDKLVADNPYYAKA
TIPGGLYNNNPEDTETFGVLATLVTSANVPEESVYALTKAVFENFDEFKSLHPAFANLEP
AKMIKDGLSAPLHPGAEKYYKEKGWLK