Protein Info for SM_b20291 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 827 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 324 to 349 (26 residues), see Phobius details amino acids 356 to 374 (19 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details amino acids 424 to 441 (18 residues), see Phobius details amino acids 476 to 501 (26 residues), see Phobius details amino acids 507 to 530 (24 residues), see Phobius details amino acids 537 to 562 (26 residues), see Phobius details amino acids 568 to 591 (24 residues), see Phobius details amino acids 604 to 628 (25 residues), see Phobius details amino acids 634 to 656 (23 residues), see Phobius details amino acids 662 to 682 (21 residues), see Phobius details amino acids 791 to 810 (20 residues), see Phobius details TIGR02123: TRAP transporter, 4TM/12TM fusion protein" amino acids 2 to 686 (685 residues), 686.7 bits, see alignment E=1.8e-210 PF06808: DctM" amino acids 98 to 361 (264 residues), 152.3 bits, see alignment E=1.9e-48 amino acids 358 to 629 (272 residues), 98.6 bits, see alignment E=3.7e-32 PF11874: DUF3394" amino acids 635 to 813 (179 residues), 204.4 bits, see alignment E=1.2e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20291)

Predicted SEED Role

"TRAP-type uncharacterized transport system, fused permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WP8 at UniProt or InterPro

Protein Sequence (827 amino acids)

>SM_b20291 hypothetical protein (Sinorhizobium meliloti 1021)
MAWSLFQLWYASPLPFVFGFGILNDTEARAIHLGFALFLTFLAYPALKSSPRDRVPLADW
VLGALGAFAGAYLFLFYGELAGRPGQPSTLDLVTGTAGILLLLEATRRALGLPMVFVAGV
FIFYTFAGQYMPDVIQHRGASLVKFINHQWLTTEGVFGIALGVSTSFVFLFVLFGTLLEK
AGAGNWMMQISIALLGHLRGGPAKVAVVSSALNGVVSGSSVSNVVSGGIFTIPLMKRTGL
SGVKAGAIEASASINGQIMPPVMGAAAFLMVEYVGIPYSEIVKHALLPAVFSYIALLYMV
HLEAVKLNMQPIPQRPTPMRERWLRMGLGLAGSVLAICLLYYGIIAIRAAFGESAPLLLA
IAGVALYIATIWYSSRYPDLELDDPDAPILELPRAWDVTRTGLDFLIPIVVLLWCLMVEQ
LSPGLSAFWATLTIIAIVATRKPLMAIFRKEDVAGSVRAAAWDLTDGLALGARNMIGIAV
ATATAGIVVGTITLTGLGLMMTELVEFISGGNVIMMLILIAAISLVLGMGIPTTANYILV
ATLMAPVVVELGSQAGLAIPLIAVHLFVFYFGIMADITPPVGLAAFAAAAISKEDPIATG
FQGALYSLRTAILPFVFIFNPAILLIGVDTWAHTIWVAAISLAAILIFSAATMNWFVTKS
RLWESAVLLLVCFTLFRPDWWLNQISPPYEELPASEFLRAVEEAPAKSRINFVVQGFDLM
GDEVRKTVNVPLGEPGEPLQRLQSIGLTVTPAGESLMISNVDFGSYAKRIGLDVGFDIVA
VLRKAEQPSSAIPVGIALAVTAGIAGLQFARKRADRSEAGLTGAARK