Protein Info for SM_b20289 in Sinorhizobium meliloti 1021

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 407 to 430 (24 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 20 to 398 (379 residues), 224 bits, see alignment E=1.4e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20289)

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WQ0 at UniProt or InterPro

Protein Sequence (449 amino acids)

>SM_b20289 permease (Sinorhizobium meliloti 1021)
MTGNKIDSIDPTDEVLPPRSLVLFGLQHVLVMAASPITAVFLVSKALGFSDALTVSLISA
TFLICGLGTILQSFGPAGFGARLPFIMVPGGAPIAIFLAIAQQTDVQTAVGAVILTAGFY
FLALPVFRRLLRYFPPIVVGTMLLLVSVNLVRIYGGTITGKQGSEGFADPMNVGLALATI
ALTVIFARVFTGTLQRISVMFGLIAGSAIAIGAGYMDLSGIFDGPVIAMPQLLPFGMPKF
DFFAALPLIVFSIISMAEATGQTIATAEIVGRRGDAHAIVPATIRGDAVASLVGGLFGTS
LIITSGENVGIVRATNVKSRYVTATAGVILVLIALFAPVGRLASALPGPVVGGTAVIVFS
IIGVIGIDLLRRVDLREHGPMFTLAAALSMGLLPILVPGVYSQFPPWSQMILANGLAAGT
ITAVIVNAFFQHLPLEQFQEKCAAVFRPE