Protein Info for SM_b20280 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 45 to 62 (18 residues), see Phobius details amino acids 98 to 114 (17 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 44 to 260 (217 residues), 43.3 bits, see alignment E=6.6e-15 PF13454: NAD_binding_9" amino acids 46 to 189 (144 residues), 32.7 bits, see alignment E=1.5e-11 PF13738: Pyr_redox_3" amino acids 46 to 260 (215 residues), 54.1 bits, see alignment E=3e-18 PF13434: Lys_Orn_oxgnase" amino acids 127 to 260 (134 residues), 47 bits, see alignment E=4.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20280)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WQ9 at UniProt or InterPro

Protein Sequence (488 amino acids)

>SM_b20280 hypothetical protein (Sinorhizobium meliloti 1021)
MTNEQHGRLAELNARVKQDLDYLNYPAANWSKPVTTADGQPVSDVVIIGGGMCGMVAWLA
LTRAGIANLRIVDRAPKGQEGPWVTFARMETLRSPKNLLGPALGMASLTFRAWYTACFGE
AAWETLFRIPRPMWMDYLKWYREVLSIPVENDTHVTRVRPREDGLLELEIAGGSKSSIVT
RKLVLATGREGLGEPVVPDFVKGMKRHTSWAHSADDIDFEALKAKRVVVIGVGASAVDNA
AEALESDAGEVRLLARRKEMPTVNKLMGIGSYGVTAGFARIDAEWRWRIMDYSVKQQTPA
PHNSTLRVSRHPNAFFHFDCAIGSMREEGGEVVITTKKGRIFRTDFVILGTGFTVDPLSR
DELAPYQDRIACWDDRYTPPVGEENAGLGRFPWLDDDFSFTEKEPGTAPWLKDIHCFNYG
ASISIGKVSGDIPAISEGALWLARGIAASLFIRDVDYHWEALLAYEKPELDGSEWTDADA
PEPAHRTA