Protein Info for SM_b20265 in Sinorhizobium meliloti 1021

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 160 to 178 (19 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 11 to 108 (98 residues), 51.1 bits, see alignment E=8.1e-18 PF00528: BPD_transp_1" amino acids 32 to 213 (182 residues), 59.8 bits, see alignment E=1.5e-20

Best Hits

KEGG orthology group: K10040, putative glutamine transport system permease protein (inferred from 100% identity to smk:Sinme_3908)

Predicted SEED Role

"Probable permease of ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WS4 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SM_b20265 amino acid ABC transporter permease (Sinorhizobium meliloti 1021)
MFDTALTWNDLAFLAQGAGMTLAVTAVAVTAGTVLGILFGVIRFQIGPYWSAPLTLLLDV
FRSVPLLIQLVLGNAFQSIAKLGWGAFTTSGVVLSLYTAAFCAEIVRGGISSVPVTTRRA
ARSLGMTWWQDMRYIVAPLATRVSLPSWIGLTLGVMKDSALVLWLGLVELLRASQILVTR
LQEPLFILLICGAIYFLLSFPVARLGGYLEKRWSPND