Protein Info for SM_b20245 in Sinorhizobium meliloti 1021

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 PF02719: Polysacc_synt_2" amino acids 4 to 120 (117 residues), 31.8 bits, see alignment E=3.6e-11 PF01370: Epimerase" amino acids 4 to 276 (273 residues), 183.5 bits, see alignment E=1.8e-57 PF01073: 3Beta_HSD" amino acids 5 to 129 (125 residues), 75.1 bits, see alignment E=2e-24 PF16363: GDP_Man_Dehyd" amino acids 5 to 138 (134 residues), 78.4 bits, see alignment E=2.9e-25 amino acids 165 to 339 (175 residues), 72.9 bits, see alignment E=1.4e-23 PF13460: NAD_binding_10" amino acids 8 to 126 (119 residues), 43.4 bits, see alignment E=1.4e-14 PF07993: NAD_binding_4" amino acids 62 to 228 (167 residues), 27.7 bits, see alignment E=6.2e-10

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to smk:Sinme_3928)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WU4 at UniProt or InterPro

Protein Sequence (368 amino acids)

>SM_b20245 UDP-glucose 4-epimerase (Sinorhizobium meliloti 1021)
MTKVLVTGGCGFIGRHVVEELLSRNYDLRVLDALNDQVHADAQVTLPPEVDMRRADICDA
DAVKSALKDVDHVIHLAAEVGVGQSMYEISRYVGVNDLGTAVLLEAMIGMPIRRIVVASS
MSVYGEGLYETTAGERRAHIRRSPAEIKAGAWNPSGPDGERLRPIATDENKPVDLASIYA
LTKYAQERQVLIFGEAYGTDAVALRLFNVYGAGQALSNPYTGVLANFASRLANGQSPMVF
EDGRQKRDFVHVRDVARAFRLALEQPHAAGHVINIGSGNAYAIADIASLLAEAMGVPDIE
PEIINKARSGDIRNCFADIAKARDLLGFEPAHRLEDSLADFAQWVRSAGAIDRGAEMKRH
LEARGLVL