Protein Info for SM_b20219 in Sinorhizobium meliloti 1021

Annotation: response regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 107.6 bits, see alignment E=4.1e-35 PF00486: Trans_reg_C" amino acids 159 to 235 (77 residues), 71 bits, see alignment E=7.1e-24

Best Hits

Swiss-Prot: 46% identical to OMPR_SALTY: Transcriptional regulatory protein OmpR (ompR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_3952)

Predicted SEED Role

"Transcriptional regulatory protein ompR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WW5 at UniProt or InterPro

Protein Sequence (245 amino acids)

>SM_b20219 response regulator protein (Sinorhizobium meliloti 1021)
MEHIDHILIVDDDREIRELVSAYLKKNGLRVTAVADGRQMRTFLEANTVDLIILDLMMPG
DDGLVLSRELRVGRHKATPIVMLTARSDEMDRIIGLEMGADDYIAKPFSARELLARIKAV
LRRARMLPANLQVSEAGQLLRFGQWKLDTTARHLIDADGTAIALSGAEYRLLRVFVDHPQ
RVLNRDQLLNLTQGREAELFDRSIDLLVSRVRQRLGDDAREPTYIRTVRSEGYVFSVPVE
IMEPR