Protein Info for SM_b20202 in Sinorhizobium meliloti 1021

Annotation: fructose-1,6-bisphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00316: FBPase
  • amino acids 19 to 188 (170 residues), 127.5 bits, E=5.1e-41
• PF18913: FBPase_C
  • amino acids 195 to 328 (134 residues), 154.4 bits, E=1.3e-49

Best Hits

Swiss-Prot: 100% identical to F16PA_RHIME: Fructose-1,6-bisphosphatase class 1 (fbp) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03841, fructose-1,6-bisphosphatase I [EC: 3.1.3.11] (inferred from 100% identity to smk:Sinme_3970)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, type I (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (22/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• gluconeogenesis I (12/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• oxygenic photosynthesis (13/17 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (12/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

See Q9EXV4 at UniProt or InterPro

Protein Sequence (349 amino acids)

>SM_b20202 fructose-1,6-bisphosphatase (Sinorhizobium meliloti 1021)
MSGATLEAYLASCTARGDDLSRDVAAVIQRLAKAALDIRKLVNQGALGTAFNGTHGGSNT
DGDLQKDLDILCDDQFLTCLQGAPVACYASEELENPVLLDPSARLAVAIDPLDGSSNIDN
NVSIGTIFSVLPAAKGPDVDPSQSFLQPGNRQLAAGFFIYGPQTALVLSLGKGTEIFIFS
SRLGCFVEAYKSAIIPERAHEFAINMSNYRHWEEAIRLYVDDCLAGSEGPRERDFNMRWI
ASLVAETYRILIRGGIFLYPADGRKGYSQGRLRLVYEANPIAFIIENAGGAATTSIDRIL
DLVPENLHQRVPLVFGSRREVARITRYHVDPNMIGERAPLFGKRGLFRA