Protein Info for SM_b20200 in Sinorhizobium meliloti 1021

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00456: Transketolase_N
  • amino acids 15 to 339 (325 residues), 440.8 bits, E=8.8e-136
• TIGR00232: transketolase
  • amino acids 17 to 665 (649 residues), 796.3 bits, E=1e-243
• PF00676: E1_dh
  • amino acids 120 to 252 (133 residues), 37.5 bits, E=4.1e-13
• PF13292: DXP_synthase_N
  • amino acids 123 to 201 (79 residues), 27.8 bits, E=4.7e-10
• PF02779: Transket_pyr
  • amino acids 357 to 528 (172 residues), 189.8 bits, E=9.6e-60
• PF22613: Transketolase_C_1
  • amino acids 543 to 654 (112 residues), 134.9 bits, E=4.4e-43
• PF02780: Transketolase_C
  • amino acids 551 to 658 (108 residues), 47.2 bits, E=6.2e-16

Best Hits

Swiss-Prot: 100% identical to TKT_RHIME: Transketolase (cbbT) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 100% identity to sme:SM_b20200)

Predicted SEED Role

"Transketolase (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (22/26 steps found)
• Bifidobacterium shunt (14/15 steps found)
• Rubisco shunt (10/10 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• pentose phosphate pathway (8/8 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• oxygenic photosynthesis (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of ansamycins
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

See P58333 at UniProt or InterPro

Protein Sequence (694 amino acids)

>SM_b20200 transketolase (Sinorhizobium meliloti 1021)
MNVSQQIGPRAAASERSMADAIRFLSMDAVEKANSGHPGMPMGMADAVTVLFNRFIRIDP
SHPDWPDRDRFVLSAGHGSMLLYSLHHLIGFADMPMAELSSFRQLGSKTAGHPEYGHALG
IETTTGPLGQGISTAVGMAIAEQMMAARFGSALCNHFTYVVAGDGCLQEGISHEAIDLAG
HLKLRKLVVLWDDNRISIDGSTDLSTSMNQLARFRAAGWDAQAVDGHDPDAVAKAIERAR
RTRKPSLIACRTRIGKGAASMEGSHKTHGAALGEKEIAATREKLGWPHPPFFVPPEIKAA
WEKVATRGRTAREAWEIRLDASRSKKRYEQTVERKLDGEVGDLLARFRGAHRTRATKVAT
RQASQMALEVINGATALTIGGSADLTGSNLTLTSQTQPISPGNFKGRYLHYGIREHGMAA
AMNGIALHGGFIPYGGTFLVFSDYARGAMRLSALMGLPVIYVLTHDSIGLGEDGPTHQPV
EHLAMLRATPNLNVFRPADIIETAECWEIAIGEKNTPSVFALSRQALPMLRRTDGNENLS
ALGAYVLREARGDRDITLLATGSEVEIAVAAAERLQAEERIAAAVVSMPCWEKFEAQDAA
YHRQVLGDAPRIAIEAAGRLGWDRWMGPDSAFVGMTGFGASAPAGDLYRHFGITADHVVA
EALELLRRACPETPPIGARTGKPVAHIVRSSEEA