Protein Info for SM_b20186 in Sinorhizobium meliloti 1021

Annotation: glutathione-dependent formaldehyde-activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR02820: S-(hydroxymethyl)glutathione synthase" amino acids 3 to 183 (181 residues), 350.4 bits, see alignment E=1e-109 PF04828: GFA" amino acids 25 to 117 (93 residues), 50.8 bits, see alignment E=8.6e-18

Best Hits

Swiss-Prot: 100% identical to GFA_RHIME: Glutathione-dependent formaldehyde-activating enzyme (gfa) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03396, S-(hydroxymethyl)glutathione synthase [EC: 4.4.1.22] (inferred from 100% identity to sme:SM_b20186)

Predicted SEED Role

"Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 4.4.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92WX6 at UniProt or InterPro

Protein Sequence (189 amino acids)

>SM_b20186 glutathione-dependent formaldehyde-activating protein (Sinorhizobium meliloti 1021)
MLKLHPSIDNGFPPASPGFAGGTLKCKCASNPVTVRIGSQTAHNHACGCTKCWKPEGAIF
AQIAVVGRDNVNVTSGAEKLQVVDPSATIQRYACRDCGTHMYGRIENTKHPFYGLDFVHT
ELSDETGWSPPEFAAFVSSIIESGVNPESMPEIRARLTELGLQPYDCLSPPLMDAIATHI
AKQTGALPA